Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,931

  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 18 pts. 10,366
  2. Avatar for nicobul 22. nicobul Lv 1 16 pts. 10,335
  3. Avatar for JuliaBCollet 23. JuliaBCollet Lv 1 15 pts. 10,330
  4. Avatar for ProteinShake 24. ProteinShake Lv 1 13 pts. 10,298
  5. Avatar for heather-1 25. heather-1 Lv 1 12 pts. 10,283
  6. Avatar for ppp6 26. ppp6 Lv 1 11 pts. 10,276
  7. Avatar for BarrySampson 27. BarrySampson Lv 1 9 pts. 10,261
  8. Avatar for SWR_DMaster 28. SWR_DMaster Lv 1 8 pts. 10,249
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 8 pts. 10,230
  10. Avatar for alcor29 30. alcor29 Lv 1 7 pts. 10,215

Comments