Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,931
  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 6 pts. 10,205
  2. Avatar for Dr.Sillem 32. Dr.Sillem Lv 1 5 pts. 10,198
  3. Avatar for Hellcat6 33. Hellcat6 Lv 1 5 pts. 10,158
  4. Avatar for SuperEnzyme 34. SuperEnzyme Lv 1 4 pts. 10,005
  5. Avatar for pfirth 35. pfirth Lv 1 4 pts. 9,929
  6. Avatar for carxo 36. carxo Lv 1 3 pts. 9,879
  7. Avatar for Luca 37. Luca Lv 1 3 pts. 9,809
  8. Avatar for ShadowTactics 38. ShadowTactics Lv 1 2 pts. 9,809
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 2 pts. 9,771
  10. Avatar for pizpot 40. pizpot Lv 1 2 pts. 9,766

Comments