Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for Rechenkraft.net 11. Rechenkraft.net 1 pt. 8,931
  1. Avatar for Crossed Sticks 41. Crossed Sticks Lv 1 2 pts. 9,751
  2. Avatar for Th1sN@me!sN0tAPun 42. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,731
  3. Avatar for Hexafluorouranate 43. Hexafluorouranate Lv 1 1 pt. 9,729
  4. Avatar for abiogenesis 44. abiogenesis Lv 1 1 pt. 9,678
  5. Avatar for DScott 45. DScott Lv 1 1 pt. 9,613
  6. Avatar for jausmh 46. jausmh Lv 1 1 pt. 9,512
  7. Avatar for Trajan464 47. Trajan464 Lv 1 1 pt. 9,470
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 9,446
  9. Avatar for sandeepned 49. sandeepned Lv 1 1 pt. 9,404
  10. Avatar for breadwallet 50. breadwallet Lv 1 1 pt. 9,336

Comments