Icon representing a puzzle

2576: Revisiting Puzzle 95: Chicken

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 19, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,806
  2. Avatar for Go Science 2. Go Science 60 pts. 10,790
  3. Avatar for Contenders 3. Contenders 33 pts. 10,581
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 17 pts. 10,549
  5. Avatar for Australia 5. Australia 8 pts. 10,459
  6. Avatar for Void Crushers 6. Void Crushers 4 pts. 10,399
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 10,366
  8. Avatar for VeFold 8. VeFold 1 pt. 10,330
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 9,809
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,512

  1. Avatar for christioanchauvin 11. christioanchauvin Lv 1 46 pts. 10,549
  2. Avatar for gmn 12. gmn Lv 1 42 pts. 10,540
  3. Avatar for g_b 13. g_b Lv 1 38 pts. 10,530
  4. Avatar for meatexplosion 14. meatexplosion Lv 1 35 pts. 10,478
  5. Avatar for Bletchley Park 15. Bletchley Park Lv 1 32 pts. 10,470
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 29 pts. 10,459
  7. Avatar for georg137 17. georg137 Lv 1 27 pts. 10,416
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 24 pts. 10,399
  9. Avatar for jamiexq 19. jamiexq Lv 1 22 pts. 10,382
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 20 pts. 10,374

Comments