Icon representing a puzzle

2578: Revisiting Puzzle 96: Collagen

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
February 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,873
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 8,115
  3. Avatar for SHELL 13. SHELL 1 pt. 8,081
  4. Avatar for porpita porpita 14. porpita porpita 1 pt. 6,256
  1. Avatar for furi0us 61. furi0us Lv 1 1 pt. 8,093
  2. Avatar for U202143036 62. U202143036 Lv 1 1 pt. 8,081
  3. Avatar for maithra 63. maithra Lv 1 1 pt. 7,722
  4. Avatar for GraceChen 64. GraceChen Lv 1 1 pt. 6,256

Comments