Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since about 1 year ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 8,349

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 9,284
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 9,266
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 87 pts. 9,259
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 81 pts. 9,229
  5. Avatar for orily1337 5. orily1337 Lv 1 75 pts. 9,212
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 70 pts. 9,200
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 65 pts. 9,200
  8. Avatar for TheGUmmer 8. TheGUmmer Lv 1 60 pts. 9,169
  9. Avatar for georg137 9. georg137 Lv 1 56 pts. 9,158
  10. Avatar for meatexplosion 10. meatexplosion Lv 1 51 pts. 9,151

Comments