Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,284
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,266
  3. Avatar for Contenders 3. Contenders 33 pts. 9,259
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 9,212
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,169
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,092
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 9,078
  8. Avatar for VeFold 8. VeFold 1 pt. 9,074
  9. Avatar for Australia 9. Australia 1 pt. 9,011
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,427
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 9,284
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 9,266
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 87 pts. 9,259
  4. Avatar for bravosk8erboy 4. bravosk8erboy Lv 1 81 pts. 9,229
  5. Avatar for orily1337 5. orily1337 Lv 1 75 pts. 9,212
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 70 pts. 9,200
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 65 pts. 9,200
  8. Avatar for TheGUmmer 8. TheGUmmer Lv 1 60 pts. 9,169
  9. Avatar for georg137 9. georg137 Lv 1 56 pts. 9,158
  10. Avatar for meatexplosion 10. meatexplosion Lv 1 51 pts. 9,151

Comments