Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,349
  1. Avatar for g_b 21. g_b Lv 1 20 pts. 9,062
  2. Avatar for JuliaBCollet 22. JuliaBCollet Lv 1 18 pts. 9,042
  3. Avatar for jausmh 23. jausmh Lv 1 16 pts. 9,034
  4. Avatar for jamiexq 24. jamiexq Lv 1 15 pts. 9,025
  5. Avatar for AlkiP0Ps 25. AlkiP0Ps Lv 1 13 pts. 9,011
  6. Avatar for drjr 26. drjr Lv 1 12 pts. 8,981
  7. Avatar for alcor29 27. alcor29 Lv 1 11 pts. 8,962
  8. Avatar for nicobul 28. nicobul Lv 1 10 pts. 8,942
  9. Avatar for NinjaGreg 29. NinjaGreg Lv 1 9 pts. 8,935
  10. Avatar for roarshock 30. roarshock Lv 1 8 pts. 8,907

Comments