Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,349
  1. Avatar for heather-1 31. heather-1 Lv 1 7 pts. 8,894
  2. Avatar for Larini 32. Larini Lv 1 6 pts. 8,870
  3. Avatar for vybi 33. vybi Lv 1 6 pts. 8,862
  4. Avatar for Vinara 34. Vinara Lv 1 5 pts. 8,852
  5. Avatar for Dr.Sillem 35. Dr.Sillem Lv 1 4 pts. 8,818
  6. Avatar for Hellcat6 36. Hellcat6 Lv 1 4 pts. 8,802
  7. Avatar for pizpot 37. pizpot Lv 1 3 pts. 8,785
  8. Avatar for maithra 38. maithra Lv 1 3 pts. 8,768
  9. Avatar for ppp6 39. ppp6 Lv 1 3 pts. 8,730
  10. Avatar for hookedwarm 40. hookedwarm Lv 1 2 pts. 8,719

Comments