Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since about 1 year ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Go Science 100 pts. 9,284
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,266
  3. Avatar for Contenders 3. Contenders 33 pts. 9,259
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 9,212
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,169
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,092
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 9,078
  8. Avatar for VeFold 8. VeFold 1 pt. 9,074
  9. Avatar for Australia 9. Australia 1 pt. 9,011
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,427

  1. Avatar for bsz1208 51. bsz1208 Lv 1 1 pt. 8,487
  2. Avatar for prkfour 52. prkfour Lv 1 1 pt. 8,436
  3. Avatar for ProfVince 53. ProfVince Lv 1 1 pt. 8,433
  4. Avatar for RealPerson 54. RealPerson Lv 1 1 pt. 8,427
  5. Avatar for Swapper242 55. Swapper242 Lv 1 1 pt. 8,410
  6. Avatar for Merf 56. Merf Lv 1 1 pt. 8,408
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 8,380
  8. Avatar for zo3xiaJonWeinberg 58. zo3xiaJonWeinberg Lv 1 1 pt. 8,349
  9. Avatar for binstock 59. binstock Lv 1 1 pt. 8,296
  10. Avatar for kpretzel 60. kpretzel Lv 1 1 pt. 8,284

Comments