Icon representing a puzzle

2583: Revisiting Puzzle 109: Pumpkin

Closed since about 1 year ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
March 12, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant. Players will NOT be able to load in any previous solutions for these puzzles.

Sequence
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Go Science 100 pts. 9,284
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 60 pts. 9,266
  3. Avatar for Contenders 3. Contenders 33 pts. 9,259
  4. Avatar for Marvin's bunch 4. Marvin's bunch 17 pts. 9,212
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,169
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,092
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 9,078
  8. Avatar for VeFold 8. VeFold 1 pt. 9,074
  9. Avatar for Australia 9. Australia 1 pt. 9,011
  10. Avatar for Rechenkraft.net 10. Rechenkraft.net 1 pt. 8,427

  1. Avatar for MartinJ 61. MartinJ Lv 1 1 pt. 8,249
  2. Avatar for Sydefecks 62. Sydefecks Lv 1 1 pt. 8,209
  3. Avatar for hansvandenhof 63. hansvandenhof Lv 1 1 pt. 8,156
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 8,156
  5. Avatar for Qian Xiang 65. Qian Xiang Lv 1 1 pt. 8,143
  6. Avatar for JellyfishOliPlays 66. JellyfishOliPlays Lv 1 1 pt. 8,052
  7. Avatar for Oxyd 67. Oxyd Lv 1 1 pt. 7,776
  8. Avatar for ckspark 68. ckspark Lv 1 1 pt. 6,216
  9. Avatar for Elixir007 69. Elixir007 Lv 1 1 pt. 6,198
  10. Avatar for Unearthtw 70. Unearthtw Lv 1 1 pt. 5,789

Comments