Placeholder image of a protein
Icon representing a puzzle

2590: Electron Density Reconstruction 112

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
March 14, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,883
  2. Avatar for Contenders 2. Contenders 60 pts. 20,825
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 20,761
  4. Avatar for Go Science 4. Go Science 17 pts. 20,761
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 20,678
  6. Avatar for Australia 6. Australia 4 pts. 20,526
  7. Avatar for VeFold 7. VeFold 2 pts. 20,431
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 20,278
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 20,032
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,802

  1. Avatar for akaaka 11. akaaka Lv 1 44 pts. 20,577
  2. Avatar for SemperRabbit 12. SemperRabbit Lv 1 41 pts. 20,568
  3. Avatar for Galaxie 13. Galaxie Lv 1 37 pts. 20,538
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 34 pts. 20,526
  5. Avatar for alcor29 15. alcor29 Lv 1 31 pts. 20,506
  6. Avatar for meatexplosion 16. meatexplosion Lv 1 28 pts. 20,485
  7. Avatar for Aubade01 17. Aubade01 Lv 1 25 pts. 20,474
  8. Avatar for jamiexq 18. jamiexq Lv 1 23 pts. 20,439
  9. Avatar for ZeroLeak7 19. ZeroLeak7 Lv 1 21 pts. 20,431
  10. Avatar for carsonfb 20. carsonfb Lv 1 19 pts. 20,416

Comments