2590: Electron Density Reconstruction 112
Closed since about 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- March 14, 2025
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.
- Sequence
- TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN
Top groups
-
100 pts. 20,883
-
-
-
-
-
-
-
-
-