Placeholder image of a protein
Icon representing a puzzle

2590: Electron Density Reconstruction 112

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
March 14, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,883
  2. Avatar for Contenders 2. Contenders 60 pts. 20,825
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 20,761
  4. Avatar for Go Science 4. Go Science 17 pts. 20,761
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 20,678
  6. Avatar for Australia 6. Australia 4 pts. 20,526
  7. Avatar for VeFold 7. VeFold 2 pts. 20,431
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 20,278
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 20,032
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,802

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 20,882
  2. Avatar for gmn 2. gmn Lv 1 93 pts. 20,831
  3. Avatar for BootsMcGraw 3. BootsMcGraw Lv 1 86 pts. 20,825
  4. Avatar for Punzi Baker 3 4. Punzi Baker 3 Lv 1 80 pts. 20,783
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 74 pts. 20,761
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 68 pts. 20,755
  7. Avatar for zeroblue 7. zeroblue Lv 1 63 pts. 20,689
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 58 pts. 20,678
  9. Avatar for grogar7 9. grogar7 Lv 1 53 pts. 20,660
  10. Avatar for nicobul 10. nicobul Lv 1 49 pts. 20,620

Comments