Placeholder image of a protein
Icon representing a puzzle

2590: Electron Density Reconstruction 112

Closed since about 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
March 14, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,883
  2. Avatar for Contenders 2. Contenders 60 pts. 20,825
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 20,761
  4. Avatar for Go Science 4. Go Science 17 pts. 20,761
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 20,678
  6. Avatar for Australia 6. Australia 4 pts. 20,526
  7. Avatar for VeFold 7. VeFold 2 pts. 20,431
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 20,278
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 20,032
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,802

  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 17 pts. 20,383
  2. Avatar for dcrwheeler 22. dcrwheeler Lv 1 15 pts. 20,349
  3. Avatar for JuliaBCollet 23. JuliaBCollet Lv 1 14 pts. 20,337
  4. Avatar for manu8170 24. manu8170 Lv 1 12 pts. 20,305
  5. Avatar for jausmh 25. jausmh Lv 1 11 pts. 20,278
  6. Avatar for vs 26. vs Lv 1 10 pts. 20,158
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 9 pts. 20,150
  8. Avatar for hookedwarm 28. hookedwarm Lv 1 8 pts. 20,147
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 7 pts. 20,137
  10. Avatar for spvincent 30. spvincent Lv 1 6 pts. 20,117

Comments