Placeholder image of a protein
Icon representing a puzzle

2590: Electron Density Reconstruction 112

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 14, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,883
  2. Avatar for Contenders 2. Contenders 60 pts. 20,825
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 20,761
  4. Avatar for Go Science 4. Go Science 17 pts. 20,761
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 20,678
  6. Avatar for Australia 6. Australia 4 pts. 20,526
  7. Avatar for VeFold 7. VeFold 2 pts. 20,431
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 20,278
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 20,032
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,802

  1. Avatar for Mohoernchen 51. Mohoernchen Lv 1 1 pt. 18,069
  2. Avatar for RWoodcock 52. RWoodcock Lv 1 1 pt. 17,975
  3. Avatar for Merf 53. Merf Lv 1 1 pt. 17,970
  4. Avatar for ustbU202242497 54. ustbU202242497 Lv 1 1 pt. 17,950
  5. Avatar for stinkyfeet3016 55. stinkyfeet3016 Lv 1 1 pt. 17,873
  6. Avatar for Dora Jeng 56. Dora Jeng Lv 1 1 pt. 17,813
  7. Avatar for RoflFIN 57. RoflFIN Lv 1 1 pt. 17,777
  8. Avatar for Sammy3c2b1a0 58. Sammy3c2b1a0 Lv 1 1 pt. 17,665
  9. Avatar for furi0us 59. furi0us Lv 1 1 pt. 17,658
  10. Avatar for duyanh0511 60. duyanh0511 Lv 1 1 pt. 17,359

Comments