Placeholder image of a protein
Icon representing a puzzle

2590: Electron Density Reconstruction 112

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 14, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
TGTTTTTGATAAGA TCTTATCAAAAAC GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKRMN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 20,883
  2. Avatar for Contenders 2. Contenders 60 pts. 20,825
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 33 pts. 20,761
  4. Avatar for Go Science 4. Go Science 17 pts. 20,761
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 8 pts. 20,678
  6. Avatar for Australia 6. Australia 4 pts. 20,526
  7. Avatar for VeFold 7. VeFold 2 pts. 20,431
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 20,278
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 20,032
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,802

  1. Avatar for shoichirokanzawa 61. shoichirokanzawa Lv 1 1 pt. 16,237
  2. Avatar for Unearthtw 62. Unearthtw Lv 1 1 pt. 13,213
  3. Avatar for jacquero 63. jacquero Lv 1 1 pt. 10,830
  4. Avatar for ConejoGordo 64. ConejoGordo Lv 1 1 pt. 10,711
  5. Avatar for komoji 65. komoji Lv 1 1 pt. 10,711
  6. Avatar for Serca 66. Serca Lv 1 1 pt. 10,711
  7. Avatar for ccm_demo 67. ccm_demo Lv 1 1 pt. 10,711

Comments