Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,447
  2. Avatar for SHELL 12. SHELL 1 pt. 8,225
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,117
  4. Avatar for BearCorp 14. BearCorp 1 pt. 7,600

  1. Avatar for Vinara 31. Vinara Lv 1 6 pts. 9,913
  2. Avatar for nicobul 32. nicobul Lv 1 6 pts. 9,872
  3. Avatar for kitsoune 34. kitsoune Lv 1 4 pts. 9,743
  4. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,723
  5. Avatar for rosie4loop 36. rosie4loop Lv 1 3 pts. 9,659
  6. Avatar for zbp 37. zbp Lv 1 3 pts. 9,628
  7. Avatar for DScott 38. DScott Lv 1 3 pts. 9,607
  8. Avatar for SWR_DMaster 39. SWR_DMaster Lv 1 2 pts. 9,580
  9. Avatar for carxo 40. carxo Lv 1 2 pts. 9,521

Comments