Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,732
  2. Avatar for Go Science 2. Go Science 68 pts. 10,567
  3. Avatar for Contenders 3. Contenders 44 pts. 10,460
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,368
  5. Avatar for Australia 5. Australia 16 pts. 10,336
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,310
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 10,261
  8. Avatar for VeFold 8. VeFold 3 pts. 10,208
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,183
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,094
  1. Avatar for Vinara 31. Vinara Lv 1 6 pts. 9,913
  2. Avatar for nicobul 32. nicobul Lv 1 6 pts. 9,872
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 5 pts. 9,760
  4. Avatar for kitsoune 34. kitsoune Lv 1 4 pts. 9,743
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,723
  6. Avatar for rosie4loop 36. rosie4loop Lv 1 3 pts. 9,659
  7. Avatar for zbp 37. zbp Lv 1 3 pts. 9,628
  8. Avatar for DScott 38. DScott Lv 1 3 pts. 9,607
  9. Avatar for SWR_DMaster 39. SWR_DMaster Lv 1 2 pts. 9,580
  10. Avatar for carxo 40. carxo Lv 1 2 pts. 9,521

Comments