Icon representing a puzzle

2586: Revisiting Puzzle 110: Turkey

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 20, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,732
  2. Avatar for Go Science 2. Go Science 68 pts. 10,567
  3. Avatar for Contenders 3. Contenders 44 pts. 10,460
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,368
  5. Avatar for Australia 5. Australia 16 pts. 10,336
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 10,310
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 10,261
  8. Avatar for VeFold 8. VeFold 3 pts. 10,208
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,183
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,094
  1. Avatar for Hellcat6 41. Hellcat6 Lv 1 2 pts. 9,486
  2. Avatar for dahast.de 42. dahast.de Lv 1 2 pts. 9,447
  3. Avatar for Superphosphate 43. Superphosphate Lv 1 1 pt. 9,435
  4. Avatar for RWoodcock 44. RWoodcock Lv 1 1 pt. 9,354
  5. Avatar for froschi2 45. froschi2 Lv 1 1 pt. 9,317
  6. Avatar for AlphaFold2 46. AlphaFold2 Lv 1 1 pt. 9,311
  7. Avatar for nancy_naniewoo 47. nancy_naniewoo Lv 1 1 pt. 9,276
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 1 pt. 9,259
  9. Avatar for ckspark 49. ckspark Lv 1 1 pt. 9,234
  10. Avatar for Mohoernchen 50. Mohoernchen Lv 1 1 pt. 9,208

Comments