Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 19,658
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,817
  1. Avatar for jamestpierce 41. jamestpierce Lv 1 2 pts. 19,498
  2. Avatar for NPrincipi 42. NPrincipi Lv 1 1 pt. 19,436
  3. Avatar for pizpot 43. pizpot Lv 1 1 pt. 19,433
  4. Avatar for rosie4loop 44. rosie4loop Lv 1 1 pt. 19,337
  5. Avatar for Larini 45. Larini Lv 1 1 pt. 19,280
  6. Avatar for zbp 46. zbp Lv 1 1 pt. 19,065
  7. Avatar for carsonfb 47. carsonfb Lv 1 1 pt. 18,938
  8. Avatar for BlueCat74 48. BlueCat74 Lv 1 1 pt. 18,824
  9. Avatar for abiogenesis 49. abiogenesis Lv 1 1 pt. 18,817
  10. Avatar for wosser1 50. wosser1 Lv 1 1 pt. 18,673

Comments