Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since 12 months ago

Novice Overall Prediction Electron Density

Summary

Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 19,658
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 17,817
  1. Avatar for bergie72 61. bergie72 Lv 1 1 pt. 17,239
  2. Avatar for Dora Jeng 62. Dora Jeng Lv 1 1 pt. 17,075
  3. Avatar for AlphaFold2 63. AlphaFold2 Lv 1 1 pt. 16,514
  4. Avatar for vs 64. vs Lv 1 1 pt. 15,314
  5. Avatar for Estotijn 65. Estotijn Lv 1 1 pt. 14,551
  6. Avatar for shoichirokanzawa 66. shoichirokanzawa Lv 1 1 pt. 10,999
  7. Avatar for Deleted player 67. Deleted player 1 pt. 0
  8. Avatar for Pargelion 68. Pargelion Lv 1 1 pt. 0
  9. Avatar for Bletchley Park 69. Bletchley Park Lv 1 1 pt. 0

Comments