Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 21,798
  2. Avatar for Contenders 2. Contenders 63 pts. 21,760
  3. Avatar for Go Science 3. Go Science 37 pts. 21,620
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 21,438
  5. Avatar for Australia 5. Australia 11 pts. 21,188
  6. Avatar for VeFold 6. VeFold 5 pts. 21,029
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 20,996
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 20,952
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 20,535
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,791

  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 46 pts. 21,349
  2. Avatar for BootsMcGraw 12. BootsMcGraw Lv 1 42 pts. 21,292
  3. Avatar for nicobul 13. nicobul Lv 1 38 pts. 21,270
  4. Avatar for SemperRabbit 14. SemperRabbit Lv 1 35 pts. 21,227
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 32 pts. 21,188
  6. Avatar for akaaka 16. akaaka Lv 1 29 pts. 21,131
  7. Avatar for BarrySampson 17. BarrySampson Lv 1 27 pts. 21,029
  8. Avatar for TheGUmmer 18. TheGUmmer Lv 1 24 pts. 20,996
  9. Avatar for bravosk8erboy 19. bravosk8erboy Lv 1 22 pts. 20,980
  10. Avatar for alcor29 20. alcor29 Lv 1 20 pts. 20,967

Comments