Placeholder image of a protein
Icon representing a puzzle

2593: Electron Density Reconstruction 113

Closed since 11 months ago

Novice Overall Prediction Electron Density

Summary

Created
March 25, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
FPTIPLSRLFQNAMLRAHRLHQLAFDTYEEFEEAYIPKEQKYSFLQAPQASLCFSESIPTPSNREQAQQKSNLQLLRISLLLIQSWLEPVGFLRSVFANSLVYGASDSDVYDLLKDLEEGIQTLMGRLEDGSPRTGQAFKQTYAKFDANSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 21,798
  2. Avatar for Contenders 2. Contenders 63 pts. 21,760
  3. Avatar for Go Science 3. Go Science 37 pts. 21,620
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 21,438
  5. Avatar for Australia 5. Australia 11 pts. 21,188
  6. Avatar for VeFold 6. VeFold 5 pts. 21,029
  7. Avatar for Void Crushers 7. Void Crushers 2 pts. 20,996
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 20,952
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 20,535
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 19,791
  1. Avatar for Anfinsen_slept_here 21. Anfinsen_slept_here Lv 1 18 pts. 20,960
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 16 pts. 20,952
  3. Avatar for manu8170 23. manu8170 Lv 1 15 pts. 20,793
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 13 pts. 20,782
  5. Avatar for Idiotboy 25. Idiotboy Lv 1 12 pts. 20,599
  6. Avatar for JuliaBCollet 26. JuliaBCollet Lv 1 11 pts. 20,570
  7. Avatar for jausmh 27. jausmh Lv 1 9 pts. 20,535
  8. Avatar for toshiue 28. toshiue Lv 1 8 pts. 20,437
  9. Avatar for Aubade01 29. Aubade01 Lv 1 8 pts. 20,003
  10. Avatar for Trajan464 30. Trajan464 Lv 1 7 pts. 20,001

Comments