Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,437
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,908
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,703

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,910
  2. Avatar for orily1337 2. orily1337 Lv 1 93 pts. 9,896
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 87 pts. 9,891
  4. Avatar for Serca 4. Serca Lv 1 80 pts. 9,887
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 74 pts. 9,873
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 69 pts. 9,865
  7. Avatar for meatexplosion 7. meatexplosion Lv 1 64 pts. 9,843
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 59 pts. 9,835
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 54 pts. 9,799
  10. Avatar for jamiexq 10. jamiexq Lv 1 50 pts. 9,785

Comments