Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since about 1 year ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,910
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 9,896
  3. Avatar for Go Science 3. Go Science 41 pts. 9,890
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 9,873
  5. Avatar for VeFold 5. VeFold 14 pts. 9,865
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 9,752
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 9,748
  8. Avatar for Australia 8. Australia 2 pts. 9,694
  9. Avatar for Contenders 9. Contenders 1 pt. 9,693
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,450

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,910
  2. Avatar for orily1337 2. orily1337 Lv 1 93 pts. 9,896
  3. Avatar for SemperRabbit 3. SemperRabbit Lv 1 87 pts. 9,891
  4. Avatar for Serca 4. Serca Lv 1 80 pts. 9,887
  5. Avatar for christioanchauvin 5. christioanchauvin Lv 1 74 pts. 9,873
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 69 pts. 9,865
  7. Avatar for meatexplosion 7. meatexplosion Lv 1 64 pts. 9,843
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 59 pts. 9,835
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 54 pts. 9,799
  10. Avatar for jamiexq 10. jamiexq Lv 1 50 pts. 9,785

Comments