Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,437
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,908
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,703
  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 6 pts. 9,590
  2. Avatar for maithra 32. maithra Lv 1 5 pts. 9,583
  3. Avatar for alcor29 33. alcor29 Lv 1 5 pts. 9,563
  4. Avatar for ppp6 34. ppp6 Lv 1 4 pts. 9,557
  5. Avatar for Larini 35. Larini Lv 1 4 pts. 9,547
  6. Avatar for carsonfb 36. carsonfb Lv 1 3 pts. 9,542
  7. Avatar for nicobul 37. nicobul Lv 1 3 pts. 9,529
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 2 pts. 9,513
  9. Avatar for abiogenesis 39. abiogenesis Lv 1 2 pts. 9,504
  10. Avatar for NPrincipi 40. NPrincipi Lv 1 2 pts. 9,492

Comments