Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary

Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 9,437
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,908
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,703
  1. Avatar for Swapper242 61. Swapper242 Lv 1 1 pt. 8,985
  2. Avatar for theodore nicrominia 62. theodore nicrominia Lv 1 1 pt. 8,942
  3. Avatar for Savas 63. Savas Lv 1 1 pt. 8,908
  4. Avatar for Unearthtw 64. Unearthtw Lv 1 1 pt. 8,828
  5. Avatar for furi0us 65. furi0us Lv 1 1 pt. 8,769
  6. Avatar for Sammy3c2b1a0 66. Sammy3c2b1a0 Lv 1 1 pt. 8,703
  7. Avatar for shoichirokanzawa 67. shoichirokanzawa Lv 1 1 pt. 8,465
  8. Avatar for prkfour 68. prkfour Lv 1 1 pt. 5,020
  9. Avatar for spvincent 69. spvincent Lv 1 1 pt. 5,020

Comments