Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,910
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 9,896
  3. Avatar for Go Science 3. Go Science 41 pts. 9,890
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 9,873
  5. Avatar for VeFold 5. VeFold 14 pts. 9,865
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 9,752
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 9,748
  8. Avatar for Australia 8. Australia 2 pts. 9,694
  9. Avatar for Contenders 9. Contenders 1 pt. 9,693
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,450

  1. Avatar for akaaka 11. akaaka Lv 1 46 pts. 9,776
  2. Avatar for Galaxie 12. Galaxie Lv 1 42 pts. 9,753
  3. Avatar for TheGUmmer 13. TheGUmmer Lv 1 38 pts. 9,752
  4. Avatar for WBarme1234 14. WBarme1234 Lv 1 35 pts. 9,748
  5. Avatar for grogar7 15. grogar7 Lv 1 32 pts. 9,704
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 29 pts. 9,694
  7. Avatar for BootsMcGraw 17. BootsMcGraw Lv 1 27 pts. 9,693
  8. Avatar for NinjaGreg 18. NinjaGreg Lv 1 24 pts. 9,677
  9. Avatar for georg137 19. georg137 Lv 1 22 pts. 9,674
  10. Avatar for Aubade01 20. Aubade01 Lv 1 20 pts. 9,669

Comments