Icon representing a puzzle

2589: Revisiting Puzzle 111: Mouse

Closed since 12 months ago

Novice Overall Prediction

Summary

Created
March 26, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,910
  2. Avatar for Marvin's bunch 2. Marvin's bunch 65 pts. 9,896
  3. Avatar for Go Science 3. Go Science 41 pts. 9,890
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 9,873
  5. Avatar for VeFold 5. VeFold 14 pts. 9,865
  6. Avatar for Void Crushers 6. Void Crushers 7 pts. 9,752
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 4 pts. 9,748
  8. Avatar for Australia 8. Australia 2 pts. 9,694
  9. Avatar for Contenders 9. Contenders 1 pt. 9,693
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 9,450
  1. Avatar for jausmh 21. jausmh Lv 1 18 pts. 9,662
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 16 pts. 9,656
  3. Avatar for pizpot 23. pizpot Lv 1 15 pts. 9,647
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 13 pts. 9,645
  5. Avatar for manu8170 25. manu8170 Lv 1 12 pts. 9,640
  6. Avatar for Hellcat6 26. Hellcat6 Lv 1 11 pts. 9,640
  7. Avatar for gmn 27. gmn Lv 1 9 pts. 9,614
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 8 pts. 9,610
  9. Avatar for g_b 29. g_b Lv 1 8 pts. 9,603
  10. Avatar for BilNeutron 30. BilNeutron Lv 1 7 pts. 9,597

Comments