Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 9,093
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 8,815
  3. Avatar for Foldit Staff 13. Foldit Staff 1 pt. 5,520
  4. Avatar for Boilermakers 14. Boilermakers 1 pt. 5,520

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,956
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,941
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 10,898
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 83 pts. 10,868
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 78 pts. 10,823
  6. Avatar for g_b 6. g_b Lv 1 73 pts. 10,778
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 69 pts. 10,775
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 64 pts. 10,762
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 60 pts. 10,746
  10. Avatar for Galaxie 10. Galaxie Lv 1 56 pts. 10,742

Comments