Icon representing a puzzle

2595: Revisiting Puzzle 113: White Birch

Closed since 12 months ago

Novice Overall Prediction

Summary


Created
April 09, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Go Science 100 pts. 10,956
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,941
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,775
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 10,730
  5. Avatar for Contenders 5. Contenders 16 pts. 10,704
  6. Avatar for VeFold 6. VeFold 9 pts. 10,700
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,643
  8. Avatar for Australia 8. Australia 3 pts. 10,621
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,469
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,352

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 10,956
  2. Avatar for LociOiling 2. LociOiling Lv 1 94 pts. 10,941
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 89 pts. 10,898
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 83 pts. 10,868
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 78 pts. 10,823
  6. Avatar for g_b 6. g_b Lv 1 73 pts. 10,778
  7. Avatar for christioanchauvin 7. christioanchauvin Lv 1 69 pts. 10,775
  8. Avatar for Punzi Baker 3 8. Punzi Baker 3 Lv 1 64 pts. 10,762
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 60 pts. 10,746
  10. Avatar for Galaxie 10. Galaxie Lv 1 56 pts. 10,742

Comments