Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for CHEM1210/1020 TTU 11. CHEM1210/1020 TTU 1 pt. 9,152
  2. Avatar for OmHS 12. OmHS 1 pt. 6,348
  3. Avatar for Foldit Staff 14. Foldit Staff 1 pt. 6,348

  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,364
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 11,316
  3. Avatar for grogar7 3. grogar7 Lv 1 88 pts. 11,254
  4. Avatar for LociOiling 4. LociOiling Lv 1 82 pts. 11,233
  5. Avatar for gmn 5. gmn Lv 1 77 pts. 11,201
  6. Avatar for Galaxie 6. Galaxie Lv 1 72 pts. 11,186
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 67 pts. 11,159
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 63 pts. 11,154
  9. Avatar for alcor29 9. alcor29 Lv 1 58 pts. 11,140
  10. Avatar for SemperRabbit 10. SemperRabbit Lv 1 54 pts. 11,134

Comments