Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,364
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,266
  3. Avatar for Australia 3. Australia 44 pts. 11,154
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 11,110
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,097
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,075
  7. Avatar for Contenders 7. Contenders 5 pts. 11,046
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,019
  9. Avatar for VeFold 9. VeFold 1 pt. 10,895
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,278
  1. Avatar for Serca
    1. Serca Lv 1
    100 pts. 11,364
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 11,316
  3. Avatar for grogar7 3. grogar7 Lv 1 88 pts. 11,254
  4. Avatar for LociOiling 4. LociOiling Lv 1 82 pts. 11,233
  5. Avatar for gmn 5. gmn Lv 1 77 pts. 11,201
  6. Avatar for Galaxie 6. Galaxie Lv 1 72 pts. 11,186
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 67 pts. 11,159
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 63 pts. 11,154
  9. Avatar for alcor29 9. alcor29 Lv 1 58 pts. 11,140
  10. Avatar for SemperRabbit 10. SemperRabbit Lv 1 54 pts. 11,134

Comments