Icon representing a puzzle

2598: Revisiting Puzzle 114: Black Mamba

Closed since 12 months ago

Novice Overall Prediction

Summary


Created
April 16, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Go Science 100 pts. 11,364
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 11,266
  3. Avatar for Australia 3. Australia 44 pts. 11,154
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 11,110
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 11,097
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 11,075
  7. Avatar for Contenders 7. Contenders 5 pts. 11,046
  8. Avatar for Gargleblasters 8. Gargleblasters 3 pts. 11,019
  9. Avatar for VeFold 9. VeFold 1 pt. 10,895
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 9,278

  1. Avatar for Unearthtw 71. Unearthtw Lv 1 1 pt. 8,118
  2. Avatar for Szymszym 72. Szymszym Lv 1 1 pt. 6,827
  3. Avatar for Grey9029 73. Grey9029 Lv 1 1 pt. 6,348
  4. Avatar for ustbU202242541 74. ustbU202242541 Lv 1 1 pt. 6,348
  5. Avatar for Rato_Atomico87 75. Rato_Atomico87 Lv 1 1 pt. 6,348
  6. Avatar for szeleit 76. szeleit Lv 1 1 pt. 6,348
  7. Avatar for spvincent 77. spvincent Lv 1 1 pt. 6,348
  8. Avatar for rmoretti 78. rmoretti Lv 1 1 pt. 6,348

Comments