Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,796
  2. Avatar for Go Science 2. Go Science 60 pts. 9,787
  3. Avatar for Australia 3. Australia 33 pts. 9,769
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 9,764
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,755
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,754
  7. Avatar for VeFold 7. VeFold 2 pts. 9,729
  8. Avatar for Contenders 8. Contenders 1 pt. 9,708
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,703
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,660
  1. Avatar for hada 41. hada Lv 1 3 pts. 9,572
  2. Avatar for Larini 42. Larini Lv 1 3 pts. 9,563
  3. Avatar for pizpot 43. pizpot Lv 1 3 pts. 9,552
  4. Avatar for CAN1958 44. CAN1958 Lv 1 2 pts. 9,540
  5. Avatar for jausmh 45. jausmh Lv 1 2 pts. 9,528
  6. Avatar for Vinara 46. Vinara Lv 1 2 pts. 9,519
  7. Avatar for heather-1 47. heather-1 Lv 1 2 pts. 9,497
  8. Avatar for abiogenesis 48. abiogenesis Lv 1 2 pts. 9,491
  9. Avatar for nicobul 49. nicobul Lv 1 1 pt. 9,486
  10. Avatar for borattt 50. borattt Lv 1 1 pt. 9,464

Comments