Icon representing a puzzle

2603: Revisiting Puzzle 117: Transport Mutant

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
April 30, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,796
  2. Avatar for Go Science 2. Go Science 60 pts. 9,787
  3. Avatar for Australia 3. Australia 33 pts. 9,769
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 17 pts. 9,764
  5. Avatar for Void Crushers 5. Void Crushers 8 pts. 9,755
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 4 pts. 9,754
  7. Avatar for VeFold 7. VeFold 2 pts. 9,729
  8. Avatar for Contenders 8. Contenders 1 pt. 9,708
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 9,703
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 9,660
  1. Avatar for aethernum 71. aethernum Lv 1 1 pt. 8,839
  2. Avatar for drumpeter18yrs9yrs 72. drumpeter18yrs9yrs Lv 1 1 pt. 8,806
  3. Avatar for efull 73. efull Lv 1 1 pt. 8,668
  4. Avatar for Anvani_09118 74. Anvani_09118 Lv 1 1 pt. 8,656
  5. Avatar for Atit Areweepon 75. Atit Areweepon Lv 1 1 pt. 8,643
  6. Avatar for Dagahn 76. Dagahn Lv 1 1 pt. 8,482
  7. Avatar for furi0us 77. furi0us Lv 1 1 pt. 8,378
  8. Avatar for buatennyson 78. buatennyson Lv 1 1 pt. 1,289
  9. Avatar for toshiue 79. toshiue Lv 1 1 pt. 1,289
  10. Avatar for Rato_Atomico87 80. Rato_Atomico87 Lv 1 1 pt. 1,289

Comments