Placeholder image of a protein
Icon representing a puzzle

2610: Electron Density Reconstruction 118

Closed since 12 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 07, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It has 5 parts, and several of the segments won't be visible as they are missing in the data.

Sequence
PGPPQGPPQPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFWWKNCKM GKSASGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKAVKYQSKAR NGEVEVPKTELEEIQQQCNQVTDDSLESTRRMLNMCEESKEAGIRTLVMLDEQGEQLDRIEEGLDQINQDMKDAEKNLEGMEK VTVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKLLKN GKSASGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEGRVGRKK

Top groups


  1. Avatar for GENE 433 12. GENE 433 1 pt. 37,465
  2. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 37,212

  1. Avatar for MicElephant 21. MicElephant Lv 1 19 pts. 40,487
  2. Avatar for Idiotboy 22. Idiotboy Lv 1 17 pts. 40,407
  3. Avatar for toshiue 23. toshiue Lv 1 15 pts. 40,390
  4. Avatar for BootsMcGraw 24. BootsMcGraw Lv 1 14 pts. 40,360
  5. Avatar for nicobul 25. nicobul Lv 1 12 pts. 40,269
  6. Avatar for alcor29 26. alcor29 Lv 1 11 pts. 40,257
  7. Avatar for JuliaBCollet 27. JuliaBCollet Lv 1 10 pts. 40,243
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 9 pts. 40,178
  9. Avatar for vs 29. vs Lv 1 8 pts. 40,157
  10. Avatar for g_b 30. g_b Lv 1 7 pts. 40,121

Comments