Placeholder image of a protein
Icon representing a puzzle

2610: Electron Density Reconstruction 118

Closed since 12 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
May 07, 2025
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. It has 5 parts, and several of the segments won't be visible as they are missing in the data.

Sequence
PGPPQGPPQPVQQSKRLQQTQAQVEEVVDIMRVNVDKVLERDSKISELDDRADALQAGASQFEASAGKLKRKFWWKNCKM GKSASGIIMETQQAKQTLADIEARHADIMKLETSIRELHDMFMDMAMLVESQGEMIDRIEYNVEAAVDYIETAKVDTKKAVKYQSKAR NGEVEVPKTELEEIQQQCNQVTDDSLESTRRMLNMCEESKEAGIRTLVMLDEQGEQLDRIEEGLDQINQDMKDAEKNLEGMEK VTVGDQNGMGPSSGYVTRITNDAREDDMENNMKEVSSMIGNLRNMAIDMGNEIGSQNRQVDRIQQKAESNESRIDEANKKATKLLKN GKSASGEKEGNENAEEEAAAIEEARREAEERRKEKHRKMEEEREEMRQTIRDKYGLKKKVKEEPEAEADLDEGRVGRKK

Top groups


  1. Avatar for GENE 433 12. GENE 433 1 pt. 37,465
  2. Avatar for Andrew's Foldit group 13. Andrew's Foldit group 1 pt. 37,212

  1. Avatar for maithra 31. maithra Lv 1 6 pts. 39,839
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 6 pts. 39,825
  3. Avatar for jamiexq 33. jamiexq Lv 1 5 pts. 39,787
  4. Avatar for drumpeter18yrs9yrs 34. drumpeter18yrs9yrs Lv 1 4 pts. 39,669
  5. Avatar for Trajan464 35. Trajan464 Lv 1 4 pts. 39,437
  6. Avatar for manu8170 36. manu8170 Lv 1 3 pts. 39,366
  7. Avatar for Larini 37. Larini Lv 1 3 pts. 39,349
  8. Avatar for hookedwarm 38. hookedwarm Lv 1 3 pts. 39,201
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 2 pts. 39,201
  10. Avatar for zxspectrum 40. zxspectrum Lv 1 2 pts. 39,184

Comments