Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,074
  2. Avatar for Go Science 2. Go Science 65 pts. 11,052
  3. Avatar for VeFold 3. VeFold 41 pts. 10,979
  4. Avatar for Australia 4. Australia 24 pts. 10,854
  5. Avatar for Contenders 5. Contenders 14 pts. 10,831
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,826
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,717
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 10,628
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,348
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,348
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,074
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 94 pts. 11,044
  3. Avatar for Serca 3. Serca Lv 1 88 pts. 11,044
  4. Avatar for SemperRabbit 4. SemperRabbit Lv 1 82 pts. 11,007
  5. Avatar for grogar7 5. grogar7 Lv 1 77 pts. 10,992
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 72 pts. 10,979
  7. Avatar for akaaka 7. akaaka Lv 1 67 pts. 10,904
  8. Avatar for gmn 8. gmn Lv 1 62 pts. 10,901
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 58 pts. 10,899
  10. Avatar for AlkiP0Ps 10. AlkiP0Ps Lv 1 54 pts. 10,854

Comments