Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups



  1. Avatar for NinjaGreg 21. NinjaGreg Lv 1 22 pts. 10,652
  2. Avatar for g_b 22. g_b Lv 1 20 pts. 10,643
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 19 pts. 10,628
  4. Avatar for alcor29 24. alcor29 Lv 1 17 pts. 10,617
  5. Avatar for NPrincipi 25. NPrincipi Lv 1 15 pts. 10,587
  6. Avatar for JuliaBCollet 26. JuliaBCollet Lv 1 14 pts. 10,570
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 13 pts. 10,565
  8. Avatar for drumpeter18yrs9yrs 28. drumpeter18yrs9yrs Lv 1 12 pts. 10,542
  9. Avatar for amakedon 29. amakedon Lv 1 11 pts. 10,495
  10. Avatar for pizpot 30. pizpot Lv 1 10 pts. 10,471

Comments