Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,067
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,719
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 8,165
  1. Avatar for Dr.Sillem 31. Dr.Sillem Lv 1 9 pts. 10,465
  2. Avatar for vybi 32. vybi Lv 1 8 pts. 10,448
  3. Avatar for Larini 33. Larini Lv 1 7 pts. 10,439
  4. Avatar for manu8170 34. manu8170 Lv 1 6 pts. 10,439
  5. Avatar for Alistair69 35. Alistair69 Lv 1 6 pts. 10,416
  6. Avatar for jamiexq 36. jamiexq Lv 1 5 pts. 10,403
  7. Avatar for nicobul 37. nicobul Lv 1 5 pts. 10,379
  8. Avatar for heather-1 38. heather-1 Lv 1 4 pts. 10,368
  9. Avatar for jausmh 39. jausmh Lv 1 4 pts. 10,348
  10. Avatar for Joanna_H 40. Joanna_H Lv 1 3 pts. 10,348

Comments