Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,067
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 9,719
  3. Avatar for Intellectual decay of Brazil (IDEB) 13. Intellectual decay of Brazil (IDEB) 1 pt. 8,165
  1. Avatar for zanbato 51. zanbato Lv 1 1 pt. 10,067
  2. Avatar for carxo 52. carxo Lv 1 1 pt. 9,935
  3. Avatar for Trajan464 53. Trajan464 Lv 1 1 pt. 9,911
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 9,901
  5. Avatar for pfirth 55. pfirth Lv 1 1 pt. 9,731
  6. Avatar for Mohoernchen 56. Mohoernchen Lv 1 1 pt. 9,726
  7. Avatar for Savas 57. Savas Lv 1 1 pt. 9,719
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,694
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 9,671
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 9,642

Comments