Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups



  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 1 pt. 9,632
  2. Avatar for froschi2 62. froschi2 Lv 1 1 pt. 9,626
  3. Avatar for Fasodankfds 63. Fasodankfds Lv 1 1 pt. 9,554
  4. Avatar for azzencrusher 64. azzencrusher Lv 1 1 pt. 9,497
  5. Avatar for momadoc 65. momadoc Lv 1 1 pt. 9,476
  6. Avatar for xspectrum 66. xspectrum Lv 1 1 pt. 9,467
  7. Avatar for futsall 67. futsall Lv 1 1 pt. 9,456
  8. Avatar for efull 68. efull Lv 1 1 pt. 9,451
  9. Avatar for Eugen 69. Eugen Lv 1 1 pt. 9,420
  10. Avatar for Swapper242 70. Swapper242 Lv 1 1 pt. 9,351

Comments