Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Go Science 2. Go Science 65 pts. 11,052
  3. Avatar for VeFold 3. VeFold 41 pts. 10,979
  4. Avatar for Australia 4. Australia 24 pts. 10,854
  5. Avatar for Contenders 5. Contenders 14 pts. 10,831
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,826
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,717
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 10,628
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,348
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,348

  1. Avatar for meatexplosion 11. meatexplosion Lv 1 50 pts. 10,839
  2. Avatar for MicElephant 12. MicElephant Lv 1 46 pts. 10,831
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 43 pts. 10,826
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 40 pts. 10,819
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 37 pts. 10,812
  6. Avatar for Galaxie 16. Galaxie Lv 1 34 pts. 10,787
  7. Avatar for BarrySampson 17. BarrySampson Lv 1 31 pts. 10,780
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 29 pts. 10,780
  9. Avatar for TheGUmmer 19. TheGUmmer Lv 1 26 pts. 10,717
  10. Avatar for LHOr 20. LHOr Lv 1 24 pts. 10,682

Comments