Icon representing a puzzle

2606: Revisiting Puzzle 124: PDZ Domain

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 07, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,074
  2. Avatar for Go Science 2. Go Science 65 pts. 11,052
  3. Avatar for VeFold 3. VeFold 41 pts. 10,979
  4. Avatar for Australia 4. Australia 24 pts. 10,854
  5. Avatar for Contenders 5. Contenders 14 pts. 10,831
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 10,826
  7. Avatar for Void Crushers 7. Void Crushers 4 pts. 10,717
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 2 pts. 10,628
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 10,348
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,348

  1. Avatar for hada 41. hada Lv 1 3 pts. 10,337
  2. Avatar for maithra 42. maithra Lv 1 3 pts. 10,319
  3. Avatar for zxspectrum 43. zxspectrum Lv 1 2 pts. 10,289
  4. Avatar for vs 44. vs Lv 1 2 pts. 10,269
  5. Avatar for toshiue 45. toshiue Lv 1 2 pts. 10,259
  6. Avatar for badgoes 46. badgoes Lv 1 2 pts. 10,256
  7. Avatar for abiogenesis 47. abiogenesis Lv 1 1 pt. 10,182
  8. Avatar for hookedwarm 48. hookedwarm Lv 1 1 pt. 10,118
  9. Avatar for Crossed Sticks 49. Crossed Sticks Lv 1 1 pt. 10,078
  10. Avatar for zbp 50. zbp Lv 1 1 pt. 10,073

Comments