Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 10 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for gmn 11. gmn Lv 1 51 pts. 10,137
  2. Avatar for vs 12. vs Lv 1 47 pts. 10,132
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 44 pts. 10,132
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 41 pts. 10,119
  5. Avatar for Joanna_H 15. Joanna_H Lv 1 38 pts. 10,112
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 35 pts. 10,109
  7. Avatar for grogar7 17. grogar7 Lv 1 32 pts. 10,098
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 30 pts. 10,096
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 27 pts. 10,090
  10. Avatar for g_b 20. g_b Lv 1 25 pts. 10,088

Comments