Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 11 months ago

Novice Overall Prediction

Summary

Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714
  1. Avatar for Idiotboy 51. Idiotboy Lv 1 1 pt. 9,508
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 9,485
  3. Avatar for vybi 53. vybi Lv 1 1 pt. 9,434
  4. Avatar for nancy_naniewoo 54. nancy_naniewoo Lv 1 1 pt. 9,422
  5. Avatar for maithra 55. maithra Lv 1 1 pt. 9,417
  6. Avatar for RWoodcock 56. RWoodcock Lv 1 1 pt. 9,347
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 9,347
  8. Avatar for Trajan464 58. Trajan464 Lv 1 1 pt. 9,341
  9. Avatar for prkfour 59. prkfour Lv 1 1 pt. 9,277
  10. Avatar for efull 60. efull Lv 1 1 pt. 9,203

Comments