Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since about 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,190
  2. Avatar for DSN @ Home 12. DSN @ Home 1 pt. 8,714

  1. Avatar for AsmarAyd 61. AsmarAyd Lv 1 1 pt. 9,190
  2. Avatar for DScott 62. DScott Lv 1 1 pt. 9,187
  3. Avatar for Merf 63. Merf Lv 1 1 pt. 9,183
  4. Avatar for win99 64. win99 Lv 1 1 pt. 9,164
  5. Avatar for futsall 65. futsall Lv 1 1 pt. 9,137
  6. Avatar for rinze 66. rinze Lv 1 1 pt. 9,017
  7. Avatar for jdmclure 67. jdmclure Lv 1 1 pt. 8,994
  8. Avatar for TryinToHelp 68. TryinToHelp Lv 1 1 pt. 8,965
  9. Avatar for Fasodankfds 69. Fasodankfds Lv 1 1 pt. 8,941
  10. Avatar for Maxi54 70. Maxi54 Lv 1 1 pt. 8,896

Comments