Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for gmn 11. gmn Lv 1 51 pts. 10,137
  2. Avatar for vs 12. vs Lv 1 47 pts. 10,132
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 44 pts. 10,132
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 41 pts. 10,119
  5. Avatar for Joanna_H 15. Joanna_H Lv 1 38 pts. 10,112
  6. Avatar for BarrySampson 16. BarrySampson Lv 1 35 pts. 10,109
  7. Avatar for grogar7 17. grogar7 Lv 1 32 pts. 10,098
  8. Avatar for BootsMcGraw 18. BootsMcGraw Lv 1 30 pts. 10,096
  9. Avatar for NinjaGreg 19. NinjaGreg Lv 1 27 pts. 10,090
  10. Avatar for g_b 20. g_b Lv 1 25 pts. 10,088

Comments