Icon representing a puzzle

2609: Revisiting Puzzle 125: Ice Binding Protein

Closed since 11 months ago

Novice Overall Prediction

Summary


Created
May 14, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,201
  2. Avatar for Go Science 2. Go Science 63 pts. 10,195
  3. Avatar for Contenders 3. Contenders 37 pts. 10,157
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 10,148
  5. Avatar for Australia 5. Australia 11 pts. 10,119
  6. Avatar for Gargleblasters 6. Gargleblasters 5 pts. 10,112
  7. Avatar for VeFold 7. VeFold 2 pts. 10,109
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 1 pt. 10,069
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,039
  10. Avatar for Marvin's bunch 10. Marvin's bunch 1 pt. 10,014

  1. Avatar for Idiotboy 51. Idiotboy Lv 1 1 pt. 9,508
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 9,485
  3. Avatar for vybi 53. vybi Lv 1 1 pt. 9,434
  4. Avatar for nancy_naniewoo 54. nancy_naniewoo Lv 1 1 pt. 9,422
  5. Avatar for maithra 55. maithra Lv 1 1 pt. 9,417
  6. Avatar for RWoodcock 56. RWoodcock Lv 1 1 pt. 9,347
  7. Avatar for carxo 57. carxo Lv 1 1 pt. 9,347
  8. Avatar for Trajan464 58. Trajan464 Lv 1 1 pt. 9,341
  9. Avatar for prkfour 59. prkfour Lv 1 1 pt. 9,277
  10. Avatar for efull 60. efull Lv 1 1 pt. 9,203

Comments